Recombinant Human CD70 Protein, C-His-tagged

• Cat.No.: CD70-206H
• Product Overview: Recombinant Human CD70 Protein with C-His tag was expressed in E. coli.

Specification

• Description: CD70 is a type II transmembrane glycoprotein and a member of the tumor necrosis factor ligand superfamily (TNFSF), also known as CD27L and TNFSF7. It is normally expressed on medullary thymic epithelial cells. Its expression is induced on activated lymphoid cells (B cells, T cells, and NK cells) and dendritic cells. CD70 is a ligand for CD27, a co-stimulatory receptor that plays an important role in T cell activation and proliferation. CD70 overexpression has been reported in various tumors such as renal cell carcinoma, glioblastoma, and non-small cell lung carcinoma and it’s being actively pursued as a therapeutic target.
• Source: E. coli
• Species: Human
• Tag: His
• Molecular Mass: ~17 kDa
• AA Sequence: QRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Concentration: ≥0.5 mg/mL
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Gene Name: CD70 CD70 molecule [ Homo sapiens (human) ]
• Official Symbol: CD70
• Synonyms: CD70; CD70 molecule; CD27LG, TNFSF7, tumor necrosis factor (ligand) superfamily, member 7; CD70 antigen; CD27L; CD27-L; CD27 ligand; Ki-24 antigen; surface antigen CD70; tumor necrosis factor ligand superfamily member 7; tumor necrosis factor (ligand) superfamily, member 7; CD27LG; TNFSF7
• Gene ID: 970
• mRNA Refseq: NM_001252
• Protein Refseq: NP_001243
• MIM: 602840
• UniProt ID: P32970