Recombinant Human CD70 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CD70-2517H
• Product Overview: CD70 MS Standard C13 and N15-labeled recombinant protein (NP_001243) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 21.1 kDa
• AA Sequence: MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CD70 CD70 molecule [ Homo sapiens (human) ]
• Official Symbol: CD70
• Synonyms: CD70; CD70 molecule; CD27LG, TNFSF7, tumor necrosis factor (ligand) superfamily, member 7; CD70 antigen; CD27L; CD27-L; CD27 ligand; Ki-24 antigen; surface antigen CD70; tumor necrosis factor ligand superfamily member 7; tumor necrosis factor (ligand) superfamily, member 7; CD27LG; TNFSF7
• Gene ID: 970
• mRNA Refseq: NM_001252
• Protein Refseq: NP_001243
• MIM: 602840
• UniProt ID: P32970