Recombinant Human CD7 protein(26-180aa), His&Myc-tagged

• Cat.No.: CD7-3928H
• Product Overview: Recombinant Human CD7 protein(P09564)(26-180aa), fused with N-terminal His and C-terminal Myc tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His&Myc
• Protein Length: 26-180aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 21.5 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP

Gene Information

• Gene Name: CD7 CD7 molecule [ Homo sapiens ]
• Official Symbol: CD7
• Synonyms: CD7; CD7 molecule; CD7 antigen (p41); T-cell antigen CD7; GP40; LEU 9; p41 protein; T cell antigen CD7; T cell leukemia antigen; Tp40; TP41; T-cell leukemia antigen; T-cell surface antigen Leu-9; LEU-9
• Gene ID: 924
• mRNA Refseq: NM_006137
• Protein Refseq: NP_006128
• MIM: 186820
• UniProt ID: P09564