Recombinant Full Length Human CD7 Protein, GST-tagged
Cat.No. : | CD7-3029HF |
Product Overview : | Human CD7 full-length ORF (AAH09293, 21 a.a. - 240 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 21-240 amino acids |
Description : | This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 49.94 kDa |
AA Sequence : | PGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CD7 CD7 molecule [ Homo sapiens ] |
Official Symbol | CD7 |
Synonyms | CD7; CD7 molecule; CD7 antigen (p41); T-cell antigen CD7; GP40; LEU 9; p41 protein; T cell antigen CD7; T cell leukemia antigen; Tp40; TP41; T-cell leukemia antigen; T-cell surface antigen Leu-9; LEU-9; |
Gene ID | 924 |
mRNA Refseq | NM_006137 |
Protein Refseq | NP_006128 |
MIM | 186820 |
UniProt ID | P09564 |
◆ Recombinant Proteins | ||
Cd7-1789M | Recombinant Mouse Cd7 protein, His & T7-tagged | +Inquiry |
RFL3074MF | Recombinant Full Length Mouse T-Cell Antigen Cd7(Cd7) Protein, His-Tagged | +Inquiry |
Cd7-1790R | Recombinant Rat Cd7 protein, His & T7-tagged | +Inquiry |
CD7-226H | Active Recombinant Human CD7 Protein, His-tagged | +Inquiry |
CD7-2671H | Recombinant Human CD7 protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD7-2607HCL | Recombinant Human CD7 cell lysate | +Inquiry |
CD7-1368RCL | Recombinant Rat CD7 cell lysate | +Inquiry |
CD7-2518MCL | Recombinant Mouse CD7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD7 Products
Required fields are marked with *
My Review for All CD7 Products
Required fields are marked with *
0
Inquiry Basket