Recombinant Full Length Human CD7 Protein
Cat.No. : | CD7-6834HF |
Product Overview : | Human CD7 full-length ORF (NP_006128.1) recombinant protein without tag was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 317 amino acids |
Description : | This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development. |
Form : | Liquid |
Molecular Mass : | 25.4 kDa |
AA Sequence : | MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | CD7 CD7 molecule [ Homo sapiens (human) ] |
Official Symbol | CD7 |
Synonyms | CD7; CD7 molecule; GP40; TP41; Tp40; LEU-9; T-cell antigen CD7; CD7 antigen (p41); T-cell leukemia antigen; T-cell surface antigen Leu-9; p41 protein |
Gene ID | 924 |
mRNA Refseq | NM_006137 |
Protein Refseq | NP_006128 |
MIM | 186820 |
UniProt ID | P09564 |
◆ Recombinant Proteins | ||
CD7-832H | Recombinant Human CD7 Protein, His-tagged | +Inquiry |
CD7-2289H | Recombinant Human CD7, His-tagged | +Inquiry |
CD7-222HB | Recombinant Human CD7 protein, His-Avi-tagged, Biotinylated | +Inquiry |
CD7-5301H | Recombinant Human CD7 Protein (Met1-Pro180), C-His tagged | +Inquiry |
CD7-1452H | Recombinant Human CD7 Protein (Ala26-Pro180), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD7-2518MCL | Recombinant Mouse CD7 cell lysate | +Inquiry |
CD7-2607HCL | Recombinant Human CD7 cell lysate | +Inquiry |
CD7-1368RCL | Recombinant Rat CD7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD7 Products
Required fields are marked with *
My Review for All CD7 Products
Required fields are marked with *
0
Inquiry Basket