Recombinant Human CD58 Protein, His-tagged

• Cat.No.: CD58-201H
• Product Overview: Recombinant Human CD58 Protein with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: CD2 (also designated E-rosette receptor) interacts through its amino-terminal domain with the extracellular domain of CD58 (also designated CD2 ligand) to mediate cell adhesion. CD2/CD58 binding can enhance antigen-specific T cell activation. CD2 is a transmembrane glycoprotein that is expressed on T lymphocytes, NK cells and thymocytes, as well as on mouse B cells and rat splenic macrophages. CD58 is a heavily glycosylated protein with a broad tissue distribution in hematopoietic and other cells, including endothelium.
• Molecular Mass: ~24 kDa
• AA Sequence: FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHR
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Concentration: ≥0.5 mg/mL
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Gene Name: CD58 CD58 molecule [ Homo sapiens (human) ]
• Official Symbol: CD58
• Synonyms: CD58; CD58 molecule; CD58 antigen, (lymphocyte function associated antigen 3) , LFA3; lymphocyte function-associated antigen 3; surface glycoprotein LFA-3; CD58 antigen, (lymphocyte function-associated antigen 3); ag3; LFA3; LFA-3; FLJ23181; FLJ43722
• Gene ID: 965
• mRNA Refseq: NM_001144822
• Protein Refseq: NP_001138294
• MIM: 153420
• UniProt ID: P19256