Recombinant Full Length Human CD58 Protein

• Cat.No.: CD58-3004HF
• Product Overview: Human CD58 full-length ORF (NP_001770.1) recombinant protein without tag.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 261 amino acids
• Description: This gene encodes a member of the immunoglobulin superfamily. The encoded protein is a ligand of the T lymphocyte CD2 protein, and functions in adhesion and activation of T lymphocytes. The protein is localized to the plasma membrane. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jan 2009]
• Form: Liquid
• Molecular Mass: 28.1 kDa
• AA Sequence: MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRYALIPIPLAVITTCIVLYMNGILKCDRKPDRTNSN
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: CD58 CD58 molecule [ Homo sapiens ]
• Official Symbol: CD58
• Synonyms: CD58; CD58 molecule; CD58 antigen, (lymphocyte function associated antigen 3), LFA3; lymphocyte function-associated antigen 3; surface glycoprotein LFA-3; CD58 antigen, (lymphocyte function-associated antigen 3); ag3; LFA3; LFA-3; FLJ23181; FLJ43722
• Gene ID: 965
• mRNA Refseq: NM_001144822
• Protein Refseq: NP_001138294
• MIM: 153420
• UniProt ID: P19256