Recombinant Human CD40LG Protein

• Cat.No.: CD40LG-97H
• Product Overview: Recombinant Human CD40 Ligand is produced by our E. coli expression system and the target gene encoding Met113-Leu261 is expressed.

Specification

• Species: Human
• Source: E.coli
• Protein Length: Met113-Leu261
• Description: CD40 Ligand (CD40LG) is a type II transmembrane glycoprotein that belongs to the TNF superfamily. Like other TNF superfamily members, CD40LG exists as a trimer in membrane bound and soluble form, both of which are bioactive. CD40LG is a ligand for CD40; its ligation also initiates signal transduction in CD40LG expressing cells. CD40LG is a differentiation antigen that is expressed on the surface of T-cells. It stimulates B-cell proliferation and secretion of all immunoglobulin isotypes in the presence of cytokines. CD40LG has been shown to induce cytokine production and tumoricidal activity in peripheral blood monocytes. It also co-stimulates proliferation of activated T-cells and this is accompanied by the production of IFN-gamma, TNF-alpha, and IL2.
• Form: Lyophilized from a 0.2 um filtered solution of 20mM PB, 200mM NaCl, 0.1mM EDTA, pH 7.0.
• AA Sequence: MQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTFC SNREASSQAPFIASLCLK SPGRFERILLRAANTHSSAKPCGQQSIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKL
• Endotoxin: Less than 0.1 ng/ug (1 EU/ug).
• Purity: >95%
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
  Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
  Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
  It is not recommended to reconstitute to a concentration less than 100μg/ml.
  Dissolve the lyophilized protein in distilled water.
  Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Quality Statement: Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Shipping: The product is shipped at ambient temperature.
  Upon receipt, store it immediately at the temperature listed below.

Gene Information

• Gene Name: CD40LG CD40 ligand [ Homo sapiens (human) ]
• Official Symbol: CD40LG
• Synonyms: CD40 Ligand; CD40-L; T-Cell Antigen Gp39; TNF-Related Activation Protein; Tumor Necrosis Factor Ligand Superfamily Member 5; CD154; CD40L; TNFSF5; TRAP; IGM; IMD3; TRAP; gp39; HIGM1; T-BAM; TNFSF5; hCD40L
• Gene ID: 959
• mRNA Refseq: NM_000074.3
• Protein Refseq: NP_000065.1
• MIM: 300386
• UniProt ID: P29965