Recombinant Human CD3G protein, His&Myc-tagged

• Cat.No.: CD3G-4533H
• Product Overview: Recombinant Human CD3G protein(P09693)(23-116aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 23-116aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 18.2 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATIS

Gene Information

• Gene Name: CD3G CD3g molecule, gamma (CD3-TCR complex) [ Homo sapiens ]
• Official Symbol: CD3G
• Synonyms: CD3G; CD3g molecule, gamma (CD3-TCR complex); CD3g antigen, gamma polypeptide (TiT3 complex); T-cell surface glycoprotein CD3 gamma chain; T-cell receptor T3 gamma chain; CD3g molecule, epsilon (CD3-TCR complex); T-cell antigen receptor complex, gamma subunit of T3; T3G; CD3-GAMMA; FLJ17620; FLJ17664; FLJ79544; FLJ94613; MGC138597
• Gene ID: 917
• mRNA Refseq: NM_000073
• Protein Refseq: NP_000064
• UniProt ID: P09693