Recombinant Human CD320 Protein, C-His-tagged

• Cat.No.: CD320-238H
• Product Overview: Recombinant Human CD320 Protein with C-His tag was expressed in E. coli.

Specification

• Description: The 8D6 protein, also known as 8D6A, CD320 or FDC-SM-8D6, is a single pass, type I membrane protein with two low-density lipoprotein receptor ligand binding repeats (LDL-A modules). It is expressed by follicular dendritic cells in the germinal center and acts as a stimulatory signaling molecule. Follicular dendritic cells and T cells interact with germinal center B cells, providing signals for survival, proliferation and differentiation into memory B cells and plasma cells. A disruption of this interaction results in apoptosis of B cells. 8D6 is a growth factor required for plasma cell generation from germinal center B cells. Protein 8D6, together with HCAM (or CD44), plays a significant role in the proliferation of lymphoma cells of germinal center origin. 8D6 is responsible for enhancing proliferation while HCAM inhibits apoptosis.
• Source: E. coli
• Species: Human
• Tag: His
• Molecular Mass: ~21 kDa
• AA Sequence: SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAY
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Concentration: ≥0.5 mg/mL
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Gene Name: CD320 CD320 molecule [ Homo sapiens (human) ]
• Official Symbol: CD320
• Synonyms: CD320; CD320 molecule; 8D6; 8D6A; TCBLR; TCN2R; TCII-R; sCD320; CD320 antigen; 8D6 antigen; FDC-SM-8D6; FDC-signaling molecule 8D6; soluble CD320; transcobalamin 2 receptor; transcobalamin receptor
• Gene ID: 51293
• mRNA Refseq: NM_016579
• Protein Refseq: NP_057663
• MIM: 606475
• UniProt ID: Q9NPF0