Recombinant Human CD247 protein, His-tagged

• Cat.No.: CD247-7091H
• Product Overview: Recombinant Human CD247 (Met1~Leu160 (Accession # P20963)) protein is produced by E. coli expression system. This protein is fused with a His tag at the N-terminal.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Met1-Leu160
• Form: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
• Molecular Mass: Predicted Molecular Mass: 19.9 kDa
• AA Sequence: MGHHHHHHSGSEFMKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMA EAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQAL
• Endotoxin: <1.0EU per 1µg (determined by the LAL method)
• Purity: > 95%
• Applications: Positive Control; Immunogen; SDS-PAGE; WB.
• Stability: The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 centigrade for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
• Storage: Avoid repeated freeze/thaw cycles. Store at 2-8 centigrade for one month. Aliquot and store at -80 centigrade for 12 months.
• Reconstitution: Reconstitute in PBS or others.

Gene Information

• Gene Name: CD247 CD247 molecule [ Homo sapiens ]
• Official Symbol: CD247
• Synonyms: CD247; CD247 molecule; CD3H; CD3Q; CD3zeta chain; T3Z; CD3Z; TCRZ; CD3-ZETA
• Gene ID: 919
• mRNA Refseq: NM_000734
• Protein Refseq: NP_000725
• MIM: 186780
• UniProt ID: P20963