Recombinant Human CD164 Protein, GST-Tagged
Cat.No. : | CD164-0728H |
Product Overview : | Human CD164 full-length ORF (AAH11522.1, 1 a.a. - 197 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a transmembrane sialomucin and cell adhesion molecule that regulates the proliferation, adhesion and migration of hematopoietic progenitor cells. The encoded protein also interacts with the C-X-C chemokine receptor type 4 and may regulate muscle development. Elevated expression of this gene has been observed in human patients with Sez |
Molecular Mass : | 47.41 kDa |
AA Sequence : | MSRLSRSLLWAATCLGVLCVLSADKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFDAASFIGGIVLVLGVQAVIFFLYKFCKSKERNYHTL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CD164 CD164 molecule, sialomucin [ Homo sapiens ] |
Official Symbol | CD164 |
Synonyms | CD164; CD164 molecule, sialomucin; CD164 antigen, sialomucin; sialomucin core protein 24; MGC 24; MUC 24; MGC-24v; multi-glycosylated core protein 24; MGC-24; MUC-24; endolyn; |
Gene ID | 8763 |
mRNA Refseq | NM_001142401 |
Protein Refseq | NP_001135873 |
MIM | 603356 |
UniProt ID | Q04900 |
◆ Recombinant Proteins | ||
CD164-895R | Recombinant Rat CD164 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD164-2987HF | Recombinant Full Length Human CD164 Protein | +Inquiry |
Cd164-7154M | Recombinant Mouse Cd164 protein, His & T7-tagged | +Inquiry |
CD164-1237R | Recombinant Rat CD164 Protein | +Inquiry |
CD164-5140H | Recombinant Human CD164 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD164-1257RCL | Recombinant Rat CD164 cell lysate | +Inquiry |
CD164-1932HCL | Recombinant Human CD164 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD164 Products
Required fields are marked with *
My Review for All CD164 Products
Required fields are marked with *
0
Inquiry Basket