Recombinant Full Length Human CD164 Protein

• Cat.No.: CD164-2987HF
• Product Overview: Human CD164 full-length ORF (NP_006007.2) recombinant protein without tag.

Specification

• Description: This gene encodes a transmembrane sialomucin and cell adhesion molecule that regulates the proliferation, adhesion and migration of hematopoietic progenitor cells. The encoded protein also interacts with the C-X-C chemokine receptor type 4 and may regulate muscle development. Elevated expression of this gene has been observed in human patients with Sez
• Source: In Vitro Cell Free System
• Species: Human
• Form: Liquid
• Molecular Mass: 20.9 kDa
• Protein length: 92 amino acids
• AA Sequence: MSRLSRSLLWAATCLGVLCVLSADKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFDAASFIGGIVLVLGVQAVIFFLYKFCKSKERNYHTL
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: CD164 CD164 molecule, sialomucin [ Homo sapiens ]
• Official Symbol: CD164
• Synonyms: CD164; CD164 molecule, sialomucin; CD164 antigen, sialomucin; sialomucin core protein 24; MGC 24; MUC 24; MGC-24v; multi-glycosylated core protein 24; MGC-24; MUC-24; endolyn
• Gene ID: 8763
• mRNA Refseq: NM_001142401
• Protein Refseq: NP_001135873
• MIM: 603356
• UniProt ID: Q04900