Recombinant Human CD151 Protein, GST-Tagged
Cat.No. : | CD151-0723H |
Product Overview : | Human CD151 full-length ORF (AAH01374.1, 1 a.a. - 253 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. It is involved in cellular processes including cell adhesion and may regulate integrin trafficking and/or function. This protein enhances cell motility, invasion and metastasis of cancer cells. Multiple alternatively spliced transcript variants that encode the same protein have been described for this gene. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 53.57 kDa |
AA Sequence : | MGEFNEKKTTCGTVCLKYLLFTYNCCLWLAGLAVMAVGIWTLALKSDYISLLASGTYLATAYILVVAGTVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYAYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIFTCCLYRSLKLEHY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CD151 CD151 molecule (Raph blood group) [ Homo sapiens ] |
Official Symbol | CD151 |
Synonyms | CD151; CD151 molecule (Raph blood group); CD151 antigen, CD151 antigen (Raph blood group); CD151 antigen; PETA 3; RAPH; SFA 1; TSPAN24; tspan-24; tetraspanin-24; membrane glycoprotein SFA-1; CD151 antigen (Raph blood group); hemidesmosomal tetraspanin CD151; platelet surface glycoprotein gp27; platelet-endothelial tetraspan antigen 3; platelet-endothelial cell tetraspan antigen 3; GP27; MER2; SFA1; PETA-3; |
Gene ID | 977 |
mRNA Refseq | NM_001039490 |
Protein Refseq | NP_001034579 |
MIM | 602243 |
UniProt ID | P48509 |
◆ Recombinant Proteins | ||
CD151-894R | Recombinant Rat CD151 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD151-0905H | Recombinant Human CD151 Protein (Met1-Ser167), N-His tagged | +Inquiry |
CD151-0723H | Recombinant Human CD151 Protein, GST-Tagged | +Inquiry |
RFL3131CF | Recombinant Full Length Chlorocebus Aethiops Cd151 Antigen(Cd151) Protein, His-Tagged | +Inquiry |
CD151-1586R | Recombinant Rhesus Monkey CD151 Protein, hIgG1-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD151-7684HCL | Recombinant Human CD151 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD151 Products
Required fields are marked with *
My Review for All CD151 Products
Required fields are marked with *
0
Inquiry Basket