Recombinant Human CCND2 Protein, GST-Tagged
Cat.No. : | CCND2-0659H |
Product Overview : | Human CCND2 full-length ORF (NP_001750.1, 1 a.a. - 289 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with CDK4 or CDK6 and functions as a regulatory subunit of the complex, whose activity is required for cell cycle G1/S transition. This protein has been shown to interact with and be involved in the phosphorylation of tumor suppressor protein Rb. Knockout studies of the homologous gene in mouse suggest the essential roles of this gene in ovarian granulosa and germ cell proliferation. High level expression of this gene was observed in ovarian and testicular tumors. Mutations in this gene are associated with megalencephaly-polymicrogyria-polydactyly-hydrocephalus syndrome 3 (MPPH3). [provided by RefSeq, Sep 2014] |
Molecular Mass : | 59.5 kDa |
AA Sequence : | MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCND2 cyclin D2 [ Homo sapiens ] |
Official Symbol | CCND2 |
Synonyms | CCND2; cyclin D2; G1/S-specific cyclin-D2; G1/S specific cyclin D2; G1/S-specific cyclin D2; KIAK0002; MGC102758; |
Gene ID | 894 |
mRNA Refseq | NM_001759 |
Protein Refseq | NP_001750 |
MIM | 123833 |
UniProt ID | P30279 |
◆ Recombinant Proteins | ||
CCND2-2612H | Recombinant Human CCND2 protein, His & T7-tagged | +Inquiry |
CCND2-1220R | Recombinant Rat CCND2 Protein | +Inquiry |
CCND2-6157H | Recombinant Human CCND2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CCND2-25H | Recombinant Human CCND2 Protein (Full length), N-GST-tagged | +Inquiry |
Ccnd2-799M | Recombinant Mouse Ccnd2 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCND2-7712HCL | Recombinant Human CCND2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCND2 Products
Required fields are marked with *
My Review for All CCND2 Products
Required fields are marked with *
0
Inquiry Basket