Recombinant Human CCNB1 Protein, GST-Tagged
Cat.No. : | CCNB1-0650H |
Product Overview : | Human CCNB1 full-length ORF (NP_114172.1, 1 a.a. - 433 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). Two alternative transcripts have been found, a constitutively expressed transcript and a cell cycle-regulated transcript, that is expressed predominantly during G2/M phase. The different transcripts result from the use of alternate transcription initiation sites. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 74.7 kDa |
AA Sequence : | MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCNB1 cyclin B1 [ Homo sapiens ] |
Official Symbol | CCNB1 |
Synonyms | CCNB1; cyclin B1; CCNB; G2/mitotic-specific cyclin-B1; G2/mitotic specific cyclin B1; G2/mitotic-specific cyclin B1; |
Gene ID | 891 |
mRNA Refseq | NM_031966 |
Protein Refseq | NP_114172 |
MIM | 123836 |
UniProt ID | P14635 |
◆ Recombinant Proteins | ||
CCNB1-2225H | Recombinant Human CCNB1 Protein (1-433 aa), His-tagged | +Inquiry |
CCNB1-27519TH | Recombinant Human CCNB1, His-tagged | +Inquiry |
CCNB1-2653H | Recombinant Human CCNB1 protein(101-220 aa), N-MBP & C-His-tagged | +Inquiry |
CCNB1-1218R | Recombinant Rat CCNB1 Protein | +Inquiry |
CCNB1-2206H | Recombinant Human CCNB1 protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCNB1-303HCL | Recombinant Human CCNB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCNB1 Products
Required fields are marked with *
My Review for All CCNB1 Products
Required fields are marked with *
0
Inquiry Basket