Recombinant Human CCNB1 Protein (1-433 aa), His-tagged

Cat.No. : CCNB1-2225H
Product Overview : Recombinant Human CCNB1 Protein (1-433 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 1-433 aa
Description : Essential for the control of the cell cycle at the G2/M (mitosis) transition.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 50.3 kDa
AA Sequence : MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name CCNB1 cyclin B1 [ Homo sapiens ]
Official Symbol CCNB1
Synonyms CCNB1; cyclin B1; CCNB; G2/mitotic-specific cyclin-B1; G2/mitotic specific cyclin B1;
Gene ID 891
mRNA Refseq NM_031966
Protein Refseq NP_114172
MIM 123836
UniProt ID P14635

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CCNB1 Products

Required fields are marked with *

My Review for All CCNB1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon