Recombinant Human CCNB1 protein(11-110 aa), N-MBP & C-His-tagged

• Cat.No.: CCNB1-2654H
• Product Overview: Recombinant Human CCNB1 protein(P14635)(11-110 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: N-MBP & C-His
• ProteinLength: 11-110 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: INAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPV
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: CCNB1 cyclin B1 [ Homo sapiens ]
• Official Symbol: CCNB1
• Synonyms: CCNB1; cyclin B1; CCNB; G2/mitotic-specific cyclin-B1; G2/mitotic specific cyclin B1; G2/mitotic-specific cyclin B1
• Gene ID: 891
• mRNA Refseq: NM_031966
• Protein Refseq: NP_114172
• MIM: 123836
• UniProt ID: P14635