Recombinant Human CCNA1 protein, His-tagged
Cat.No. : | CCNA1-2205H |
Product Overview : | Recombinant Human CCNA1 protein(P78396)(1-464aa), fused to N-terminal His tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 1-464aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 54.2 kDa |
AA Sequence : | METGFPAIMYPGSFIGGWGEEYLSWEGPGLPDFVFQQQPVESEAMHCSNPKSGVVLATVARGPDACQILTRAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKKALPDCGVQEPPKQGFDIYMDELEQGDRDSCSVREGMAFEDVYEVDTGTLKSDLHFLLDFNTVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDITEGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKYEEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIVPCLSELHKAYLDIPHRPQQAIREKYKASKYLCVSLMEPPAVLLL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CCNA1 cyclin A1 [ Homo sapiens ] |
Official Symbol | CCNA1 |
Synonyms | CCNA1; cyclin A1; cyclin-A1; |
Gene ID | 8900 |
mRNA Refseq | NM_001111045 |
Protein Refseq | NP_001104515 |
MIM | 604036 |
UniProt ID | P78396 |
◆ Recombinant Proteins | ||
Ccna1-795M | Recombinant Mouse Ccna1 Protein, MYC/DDK-tagged | +Inquiry |
CCNA1-2996H | Recombinant Human CCNA1 Protein, MYC/DDK-tagged | +Inquiry |
CCNA1-2981M | Recombinant Mouse CCNA1 Protein | +Inquiry |
CCNA1-2205H | Recombinant Human CCNA1 protein, His-tagged | +Inquiry |
CCNA1-875R | Recombinant Rat CCNA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCNA1-682HCL | Recombinant Human CCNA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCNA1 Products
Required fields are marked with *
My Review for All CCNA1 Products
Required fields are marked with *
0
Inquiry Basket