Recombinant Human CCL5 protein, His-tagged
Cat.No. : | CCL5-6111H |
Product Overview : | Recombinant Human CCL5 protein(25-91 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 25-91 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | PYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS |
Gene Name | CCL5 chemokine (C-C motif) ligand 5 [ Homo sapiens ] |
Official Symbol | CCL5 |
Synonyms | CCL5; chemokine (C-C motif) ligand 5; D17S136E, SCYA5, small inducible cytokine A5 (RANTES); C-C motif chemokine 5; beta chemokine RANTES; MGC17164; RANTES; regulated upon activation; normally T expressed; and presumably secreted; SIS delta; SISd; small inducible cytokine subfamily A (Cys Cys); member 5; T cell specific protein p288; T cell specific RANTES protein; TCP228; eoCP; SIS-delta; beta-chemokine RANTES; small-inducible cytokine A5; T-cell specific protein p288; t cell-specific protein P228; T-cell-specific protein RANTES; eosinophil chemotactic cytokine; small inducible cytokine A5 (RANTES); small inducible cytokine subfamily A (Cys-Cys), member 5; regulated upon activation, normally T-expressed, and presumably secreted; SCYA5; D17S136E; |
Gene ID | 6352 |
mRNA Refseq | NM_002985 |
Protein Refseq | NP_002976 |
MIM | 187011 |
UniProt ID | P13501 |
◆ Recombinant Proteins | ||
ACTC1-818HF | Recombinant Full Length Human ACTC1 Protein, GST-tagged | +Inquiry |
ACTC1-0195H | Recombinant Human ACTC1 Protein (Asp156-Gly368), N-His-tagged | +Inquiry |
Actc1-3089M | Recombinant Mouse Actc1, His-tagged | +Inquiry |
ACTC1-4785H | Recombinant Human ACTC1 protein, His-tagged | +Inquiry |
ACTC1-268H | Recombinant Human ACTC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
ACTC1-5294H | Native Human Actin, Alpha, Cardiac Muscle 1 | +Inquiry |
ACTC1-852B | Native Bovine ACTC1 Protein | +Inquiry |
ACTC1-885B | Native Bovine ACTC1 Protein, Pyrene labeled | +Inquiry |
ACTC1-166B | Active Native bovine ACTC1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACTC1-9065HCL | Recombinant Human ACTC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACTC1 Products
Required fields are marked with *
My Review for All ACTC1 Products
Required fields are marked with *
0
Inquiry Basket