Recombinant Human ACTC1 protein, His-tagged

Cat.No. : ACTC1-4785H
Product Overview : Recombinant Human ACTC1 protein(P68032)(3-377aa), fused with C-terminal His tag, was expressed in Insect cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect cells
Tag : His
Protein Length : 3-377aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 47.4 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : DDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF
Gene Name ACTC1 actin, alpha, cardiac muscle 1 [ Homo sapiens ]
Official Symbol ACTC1
Synonyms ACTC1; actin, alpha, cardiac muscle 1; ACTC, actin, alpha, cardiac muscle; actin, alpha cardiac muscle 1; CMD1R; alpha-cardiac actin; ACTC; ASD5; CMH11; LVNC4;
Gene ID 70
mRNA Refseq NM_005159
Protein Refseq NP_005150
MIM 102540
UniProt ID P68032

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ACTC1 Products

Required fields are marked with *

My Review for All ACTC1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon