Recombinant Human ACTC1 protein, His-tagged

• Cat.No.: ACTC1-4785H
• Product Overview: Recombinant Human ACTC1 protein(P68032)(3-377aa), fused with C-terminal His tag, was expressed in Insect cells.

Specification

• Species: Human
• Source: Insect cells
• Tag: His
• Protein Length: 3-377aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 47.4 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: DDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF

Gene Information

• Gene Name: ACTC1 actin, alpha, cardiac muscle 1 [ Homo sapiens ]
• Official Symbol: ACTC1
• Synonyms: ACTC1; actin, alpha, cardiac muscle 1; ACTC, actin, alpha, cardiac muscle; actin, alpha cardiac muscle 1; CMD1R; alpha-cardiac actin; ACTC; ASD5; CMH11; LVNC4
• Gene ID: 70
• mRNA Refseq: NM_005159
• Protein Refseq: NP_005150
• MIM: 102540
• UniProt ID: P68032