Recombinant Human CCL4L2, His-tagged
Cat.No. : | CCL4L2-27831TH |
Product Overview : | Recombinant full length Human CCL4L1 with an N terminal His tag; 94 amino acids, predicted MWt 10.5kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 69 amino acids |
Description : | This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. This protein is similar to CCL4 which inhibits HIV entry by binding to the cellular receptor CCR5. The copy number of this gene varies among individuals; most individuals have 1-5 copies in the diploid genome, although rare individuals do not contain this gene at all. The human genome reference assembly contains two copies of this gene. This record represents the more telomeric gene. |
Conjugation : | HIS |
Molecular Weight : | 10.500kDa inclusive of tags |
Tissue specificity : | Detected in B-cells. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 10mM Sodium citrate, pH 3.5 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSHMAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN |
Sequence Similarities : | Belongs to the intercrine beta (chemokine CC) family. |
Gene Name | CCL4L2 chemokine (C-C motif) ligand 4-like 2 [ Homo sapiens ] |
Official Symbol | CCL4L2 |
Synonyms | CCL4L2; chemokine (C-C motif) ligand 4-like 2; |
Gene ID | 388372 |
mRNA Refseq | NM_207007 |
Protein Refseq | NP_996890 |
MIM | 610757 |
Uniprot ID | Q8NHW4 |
Chromosome Location | 17q12 |
Pathway | Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytosolic DNA-sensing pathway, organism-specific biosystem; |
◆ Recombinant Proteins | ||
CCL4L2-27831TH | Recombinant Human CCL4L2, His-tagged | +Inquiry |
CCL4L2-627H | Active Recombinant Human CCL4L2 | +Inquiry |
CCL4L2-1189H | Recombinant Human CCL4L2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL4L2 Products
Required fields are marked with *
My Review for All CCL4L2 Products
Required fields are marked with *
0
Inquiry Basket