Recombinant Human CCL20 Protein

• Cat.No.: CCL20-17H
• Product Overview: Recombinant Human CCL20 Protein without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Description: Macrophage inflammatory protein-3 alpha (MIP-3 α), also called CCL20, is expressed in the liver, lungs, lymph nodes, and peripheral blood lymphocytes. MIP-3 α expression is strongly induced by inflammatory signals, and downregulated by the anti-inflammatory cytokine interleukin 10 (IL-10). MIP-3 α signals through the G protein-coupled receptor CCR6 to function as a chemoattractant to lymphocytes and dendritic cells.
• Bio-activity: No biological activity data is available at this time.
• Molecular Mass: Monomer, 8 kDa (70 aa)
• AA Sequence: ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
• Endotoxin: ≤1 EUs/μg, Kinetic LAL
• Purity: ≥95%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution: -20 centigrade
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
• Reconstitution: Sterile water at 0.1 mg/mL
• Shipping: Room temperature
• Instructions: Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.

Gene Information

• Gene Name: CCL20 chemokine (C-C motif) ligand 20 [ Homo sapiens (human) ]
• Official Symbol: CCL20
• Synonyms: CCL20; chemokine (C-C motif) ligand 20; SCYA20, small inducible cytokine subfamily A (Cys Cys), member 20; C-C motif chemokine 20; CKb4; exodus 1; LARC; MIP 3a; ST38; exodus-1; MIP-3-alpha; CC chemokine LARC; beta chemokine exodus-1; beta-chemokine exodus-1; small-inducible cytokine A20; macrophage inflammatory protein 3 alpha; liver and activation-regulated chemokine; small inducible cytokine subfamily A (Cys-Cys), member 20; MIP3A; MIP-3a; SCYA20
• Gene ID: 6364
• mRNA Refseq: NM_001130046
• Protein Refseq: NP_001123518
• MIM: 601960
• UniProt ID: P78556