Active Recombinant Rat Ccl20 Protein (71 aa)

Cat.No. : Ccl20-170C
Product Overview : Recombinant rat MIP-3 α/CCL20 produced in HEK293 cells is a polypeptide chain containing 71 amino acids. A fully biologically active molecule, rrMIP-3 α/CCL20 has a molecular mass of 8.2 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : HEK293
Protein Length : 71
Description : Macrophage Inflammatory Protein-3 (MIP-3α), also known as chemokine (C-C motif) ligand 20 (CCL20) or liver activation regulated chemokine (LARC), is a small cytokine belonging to the CC chemokine family. It is strongly chemotactic for lymphocytes and weakly attracts neutrophils. MIP-3αis implicated in the formation and function of mucosal lymphoid tissues via chemoattraction of lymphocytes and dendritic cells toward the epithelial cells surrounding these tissues. MIP-3αis expressed in the liver, lymph nodes, appendix, PBL and lung and can signal through the CCR6 receptor.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : The EC50 value of rat MIP-3 α/CCL20 on Ca^2+ mobilization assay in CHO-K1/Gα15/rCCR6 cells (human Gα15 and rat CCR6 stably expressed in CHO-K1 cells) is less than 0.6 μg/mL.
Molecular Mass : 8.2 kDa, observed by reducing SDS-PAGE.
AA Sequence : ASNFDCCLTYTKNVYHHARNFVGFTTQMADEACDINAIIFHLKSKRSVCADPKQIWVKRILHLLSLRTKKM
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 98% as analyzed by SDS-PAGE.
Storage : Lyophilized recombinant Rat MIP-3 α/CCL20 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, recombinant Rat MIP-3 α/CCL20 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name Ccl20 chemokine (C-C motif) ligand 20 [ Rattus norvegicus ]
Official Symbol Ccl20
Synonyms CCL20; chemokine (C-C motif) ligand 20; C-C motif chemokine 20; MIP-3-alpha; CC chemokine LARC; CC chemokine ST38; beta chemokine exodus-1; beta-chemokine exodus-1; small-inducible cytokine A20; small inducible cytokine subfamily A20; macrophage inflammatory protein 3 alpha; liver and activation-regulated chemokine; ST38; Scya20;
Gene ID 29538
mRNA Refseq NM_019233
Protein Refseq NP_062106
UniProt ID P97884

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Ccl20 Products

Required fields are marked with *

My Review for All Ccl20 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon