Active Recombinant Rat Ccl20 Protein (71 aa)

• Cat.No.: Ccl20-170C
• Product Overview: Recombinant rat MIP-3 α/CCL20 produced in HEK293 cells is a polypeptide chain containing 71 amino acids. A fully biologically active molecule, rrMIP-3 α/CCL20 has a molecular mass of 8.2 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.

Specification

• Description: Macrophage Inflammatory Protein-3 (MIP-3α), also known as chemokine (C-C motif) ligand 20 (CCL20) or liver activation regulated chemokine (LARC), is a small cytokine belonging to the CC chemokine family. It is strongly chemotactic for lymphocytes and weakly attracts neutrophils. MIP-3αis implicated in the formation and function of mucosal lymphoid tissues via chemoattraction of lymphocytes and dendritic cells toward the epithelial cells surrounding these tissues. MIP-3αis expressed in the liver, lymph nodes, appendix, PBL and lung and can signal through the CCR6 receptor.
• Source: HEK 293
• Species: Rat
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: The EC50 value of rat MIP-3 α/CCL20 on Ca^2+ mobilization assay in CHO-K1/Gα15/rCCR6 cells (human Gα15 and rat CCR6 stably expressed in CHO-K1 cells) is less than 0.6 μg/mL.
• Molecular Mass: 8.2 kDa, observed by reducing SDS-PAGE.
• Protein length: 71
• AA Sequence: ASNFDCCLTYTKNVYHHARNFVGFTTQMADEACDINAIIFHLKSKRSVCADPKQIWVKRILHLLSLRTKKM
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 98% as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant Rat MIP-3 α/CCL20 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, recombinant Rat MIP-3 α/CCL20 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: Ccl20 chemokine (C-C motif) ligand 20 [ Rattus norvegicus ]
• Official Symbol: Ccl20
• Synonyms: CCL20; chemokine (C-C motif) ligand 20; C-C motif chemokine 20; MIP-3-alpha; CC chemokine LARC; CC chemokine ST38; beta chemokine exodus-1; beta-chemokine exodus-1; small-inducible cytokine A20; small inducible cytokine subfamily A20; macrophage inflammatory protein 3 alpha; liver and activation-regulated chemokine; ST38; Scya20
• Gene ID: 29538
• mRNA Refseq: NM_019233
• Protein Refseq: NP_062106
• UniProt ID: P97884