Recombinant Macaca mulatta CCL20 protein, GST-tagged

• Cat.No.: CCL20-15M
• Product Overview: Recombinant Macaca mulatta CCL20 fused with GST tag was expressed in E. coli.

Specification

• Species: Macaca mulatta
• Source: E.coli
• Tag: GST
• Form: PBS, pH 7.4, 50% glycerol
• Molecular Mass: 35.4kD
• AA Sequence: ASNFDCCLRYTDRILHPKFIVGFTQQLANETCDINAVVFHTKKGLSVCANPKQTWVKLIVRRLSKKINKM
• Purity: >90%(SDS-PAGE)
• Storage: Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade. Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.

Gene Information

• Gene Name: CCL20 C-C motif chemokine ligand 20 [ Macaca mulatta ]
• Official Symbol: CCL20
• Synonyms: CCL20; C-C motif chemokine 20; chemokine CCL20/MIP-3ALPHA
• Gene ID: 574182
• mRNA Refseq: NM_001032854
• Protein Refseq: NP_001028026
• Chromosome Location: chromosome: 12
• Pathway: Chemokine signaling pathway, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Rheumatoid arthritis, conserved biosystem