Recombinant Human CCL18 Protein

• Cat.No.: CCL18-45H
• Product Overview: Recombinant Human CCL18 Protein was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 68 amino acid
• Description: CCL18, previously identified as DC-CK1 or PARC, is expressed by dendritic cells and is chemotactic for naïve T cells. The 7 transmembrane GPCR CCR8 and the 6 transmembrane protein, membrane-associated phosphatidylinositol transfer protein 3, PITPNM3, are receptors for CCL18. The ligand was shown to have antagonist properties against CCR3.
• Form: Lyophilized
• Molecular Mass: 7.78011 kDa
• AA Sequence: QVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQI CADPNKKWVQKYISDLKLNA
• Endotoxin: Endotoxin-free <0.01 EU/ug
• Purity: Purity assessed by HPLC, Mass Spectrometry, and NMR
• Storage: Store at -20 to -80 centigrade for 12 months; Store at 4 centigrade for 6 months; Store at RT for 1 month.
• tmpcolum67: C-C motif chemokine ligand 18

Gene Information

• Gene Name: CCL18 C-C motif chemokine ligand 18 [ Homo sapiens (human) ]
• Official Symbol: CCL18
• Synonyms: CKb7; PARC; AMAC1; DCCK1; MIP-4; AMAC-1; DC-CK1; SCYA18
• Gene ID: 6362
• mRNA Refseq: NM_002988
• Protein Refseq: NP_002979
• MIM: 603757
• UniProt ID: P55774