Recombinant Human CCL18 protein

Cat.No. : CCL18-02H
Product Overview : Recombinant Human CCL18 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 69
Description : Human CCL18 is encoded by the CCL18 gene located on the chromosome 17. As also named MIP-4, it shares 61 % sequence identity to human MIP-1α. CCL18 is mainly expressed by lung and some lymphoid tissues like lymph nodes express CCL18 at low level. It is chemotactic for both activated (CD3+) T cells and nonactivated (CD14-) lymphocytes, but not for monocytes or granulocytes. Involved in B-cell migration into B-cell follicles in lymph nodes. CCL18 plays a role in both humoral and cell-mediated immunity responses.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 100 mM NaCl.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration of 1.0-10 ng/ml.
Molecular Mass : Approximately 7.9 kDa, a single non-glycosylated polypeptide chain containing 69 amino acids.
AA Sequence : AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA
Endotoxin : Less than 1 EU/μg of rHuMIP-4/CCL18 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name CCL18
Official Symbol CCL18
Synonyms CCL18; chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated); SCYA18, small inducible cytokine subfamily A (Cys Cys), member 18, pulmonary and activation regulated; C-C motif chemokine 18; AMAC 1; CKb7; DC CK1; DCCK1; MIP 4; PARC; CC chemokine PARC; CC chemokine ligand 18; chemokine (C-C), dendritic; dendritic cell chemokine 1; small inducible cytokine A18; small-inducible cytokine A18; macrophage inflammatory protein 4; pulmonary and activation-regulated chemokine; alternative macrophage activation-associated CC chemokine 1; small inducible cytokine subfamily A (Cys-Cys), member 18, pulmonary and activation-regulated; AMAC1; MIP-4; AMAC-1; DC-CK1; SCYA18;
Gene ID 6362
mRNA Refseq NM_002988
Protein Refseq NP_002979
MIM 603757
UniProt ID P55774

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CCL18 Products

Required fields are marked with *

My Review for All CCL18 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon