Recombinant Human CCL16 protein, His-SUMO-tagged

• Cat.No.: CCL16-2648H
• Product Overview: Recombinant Human CCL16 protein(O15467)(24-120aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 24-120aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 27.2 kDa
• AA Sequence: QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CCL16 chemokine (C-C motif) ligand 16 [ Homo sapiens ]
• Official Symbol: CCL16
• Synonyms: CCL16; chemokine (C-C motif) ligand 16; SCYA16, small inducible cytokine subfamily A (Cys Cys), member 16; C-C motif chemokine 16; CKb12; HCC 4; LCC 1; LEC; LMC; Mtn 1; NCC 4; SCYL4; monotactin-1; chemokine LEC; chemokine CC-4; new CC chemokine 4; liver CC chemokine-1; IL-10-inducible chemokine; liver-expressed chemokine; small-inducible cytokine A16; lymphocyte and monocyte chemoattractant; small inducible cytokine subfamily A (Cys-Cys), member 16; NCC4; HCC-4; LCC-1; Mtn-1; NCC-4; ILINCK; SCYA16; MGC117051
• Gene ID: 6360
• mRNA Refseq: NM_004590
• Protein Refseq: NP_004581
• MIM: 601394
• UniProt ID: O15467