Recombinant Human CCL16 protein
Cat.No. : | CCL16-07H |
Product Overview : | Recombinant Human CCL16 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 97 |
Description : | Human CCL16, also called Liver-expressed chemokine (LEC), Monotactin-1 (MTN-1), IL-10-inducible chemokine and so on, is expressed by the CCL16 gene located on the chromosome 17 in humans. The gene encodes a 120 a.a. residue precursor protein with a 23 a.a. residue predicted signal peptide that is cleaved to generate a 97 a.a. residue mature protein. The protein is secreted by the liver, thymus, spleen cells and showing chemotactic activity for lymphocytes and monocytes but it is distantly related to other CC chemokines, exhibiting less than 30 % sequence identity. CCL16 is highly induced by IL-10, IFN-γ and bacterial lipopolysaccharide in monmcytes and signal through CCR1, CCR2, CCR5, and CCR8. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 150 mM NaCl. |
Bio-activity : | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 10-100 ng/ml. |
Molecular Mass : | Approximately 11.2 kDa, a single non-glycosylated polypeptide chain containing 97 amino acids. |
AA Sequence : | QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ |
Endotoxin : | Less than 1 EU/μg of rHuLEC/CCL16 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | CCL16 |
Official Symbol | CCL16 |
Synonyms | CCL16; chemokine (C-C motif) ligand 16; SCYA16, small inducible cytokine subfamily A (Cys Cys), member 16; C-C motif chemokine 16; CKb12; HCC 4; LCC 1; LEC; LMC; Mtn 1; NCC 4; SCYL4; monotactin-1; chemokine LEC; chemokine CC-4; new CC chemokine 4; liver CC chemokine-1; IL-10-inducible chemokine; liver-expressed chemokine; small-inducible cytokine A16; lymphocyte and monocyte chemoattractant; small inducible cytokine subfamily A (Cys-Cys), member 16; NCC4; HCC-4; LCC-1; Mtn-1; NCC-4; ILINCK; SCYA16; MGC117051; |
Gene ID | 6360 |
mRNA Refseq | NM_004590 |
Protein Refseq | NP_004581 |
MIM | 601394 |
UniProt ID | O15467 |
◆ Recombinant Proteins | ||
CCL16-1528H | Recombinant Human CCL16 protein, His & GST-tagged | +Inquiry |
CCL16-1498H | Recombinant Human CCL16 protein, His-HA-tagged | +Inquiry |
CCL16-29941TH | Recombinant Human CCL16 | +Inquiry |
CCL16-352H | Active Recombinant Human CCL16, HIgG1 Fc-tagged, mutant | +Inquiry |
CCL16-0613H | Recombinant Human CCL16 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL16-7730HCL | Recombinant Human CCL16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL16 Products
Required fields are marked with *
My Review for All CCL16 Products
Required fields are marked with *
0
Inquiry Basket