Recombinant Human CCL16, StrepII-tagged

• Cat.No.: CCL16-296H
• Product Overview: Purified, full-length human recombinant CCL16 protein (amino acids 24-120, 97 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 11.2 kDa. (Accession NP_004581.1; UniProt O15467)

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 24-120, 97 a.a.
• Description: This protein belongs to the intercrine beta (chemokine CC) family. It shows chemotactic activity for lymphocytes and monocytes but not neutrophils. Also shows potent myelosuppressive activity, suppresses proliferation of myeloid progenitor cells. Recombinant SCYA16 shows chemotactic activity for monocytes and THP-1 monocytes, but not for resting lymphocytes and neutrophils. Induces a calcium flux in THP-1 cells that were desensitized by prior expression to RANTES.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free)
• AA Sequence: QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPT RNLSTVKIITAKNGQPQLLNSQ
• Endotoxin: <0.1 eu per μg protein by lal
• Purity: >95% by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. This solution can then be diluted into other aqueous buffers and stored at 4°C for up to 1 month.

Gene Information

• Gene Name: CCL16 chemokine (C-C motif) ligand 16 [ Homo sapiens ]
• Official Symbol: CCL16
• Synonyms: CCL16; chemokine (C-C motif) ligand 16; SCYA16, small inducible cytokine subfamily A (Cys Cys), member 16; C-C motif chemokine 16; CKb12; HCC 4; LCC 1; LEC; LMC; Mtn 1; NCC 4; SCYL4; monotactin-1; chemokine LEC; chemokine CC-4; new CC chemokine 4; liver CC chemokine-1; IL-10-inducible chemokine; liver-expressed chemokine; small-inducible cytokine A16; lymphocyte and monocyte chemoattractant; small inducible cytokine subfamily A (Cys-Cys), member 16; NCC4; HCC-4; LCC-1; Mtn-1; NCC-4; ILINCK; SCYA16; MGC117051
• Gene ID: 6360
• mRNA Refseq: NM_004590
• Protein Refseq: NP_004581
• MIM: 601394
• UniProt ID: O15467
• Chromosome Location: 17q11.2
• Pathway: Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; G alpha (i) signalling events, organism-specific biosystem
• Function: chemoattractant activity; chemokine activity