Recombinant Human CCDC74A Protein, GST-tagged

Cat.No. : CCDC74A-5201H
Product Overview : Human CCDC74A full-length ORF ( NP_620125.1, 1 a.a. - 378 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CCDC74A (Coiled-Coil Domain Containing 74A) is a Protein Coding gene. An important paralog of this gene is CCDC74B.
Molecular Mass : 68 kDa
AA Sequence : MSGAGVAAGTRPPSSPTPGSRRRRQRPSVGVQSLRPQSPQLRQSDPQKRNLDLEKSLQFLQQQHSEMLAKLHEEIEHLKRENKDLHYKLIMNQTSQKKDGPSGNHLSRASAPLGARWVCINGVWVEPGGPSPARLKEGSSRTHRPGGKRGRLAGGSADTVRSPADSLSMSSFQSVKSISNSGKARPQPGSFNKQDSKADVSQKADLEEEPLLHNSKLDKVPGVQGQARKEKAEASNAGAACMGNSQHQGRQMGAGAHPPMILPLPLRKPTTLRQCEVLIRELWNTNLLQTQELRHLKSLLEGSQRPQAAPEEASFPRDQEATHFPKVSTKSLSKKCLSPPVAERAILPALKQTPKNNFAERQKRLQAMQKRRLHRSVL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CCDC74A coiled-coil domain containing 74A [ Homo sapiens (human) ]
Official Symbol CCDC74A
Synonyms CCDC74A; coiled-coil domain containing 74A; coiled-coil domain-containing protein 74A
Gene ID 90557
mRNA Refseq NM_001258304
Protein Refseq NP_001245233
UniProt ID Q96AQ1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CCDC74A Products

Required fields are marked with *

My Review for All CCDC74A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon