Recombinant Human CCDC113 Protein, GST-tagged

• Cat.No.: CCDC113-5156H
• Product Overview: Human CCDC113 full-length ORF ( NP_054876.2, 1 a.a. - 377 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: CCDC113 (Coiled-Coil Domain Containing 113) is a Protein Coding gene.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 70.6 kDa
• AA Sequence: MTDDESESVLSDSHEGSELELPVIQLCGLVEELSYVNSALKTETEMFEKYYAKLEPRDQRPPRLSEIKISAADYAQFRGRRRSKSRTGMDRGVGLTADQKLELVQKEVADMKDDLRHTRANAERDLQHHEAIIEEAEIRWSEVSREVHEFEKDILKAISKKKGSILATQKVMKYIEDMNRRRDNMKEKLRLKNVSLKVQRKKMLLQLRQKEEVSEALHDVDFQQLKIENAQFLETIEARNQELTQLKLSSGNTLQVLNAYKSKLHKAMEIYLNLDKEILLRKELLEKIEKETLQVEEDRAKAEAVNKRLRKQLAEFRAPQVMTYVREKILNADLEKSIRMWERKVEIAEMSLKGHRKAWNRMKITNEQLQADYLAGK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CCDC113 coiled-coil domain containing 113 [ Homo sapiens (human) ]
• Official Symbol: CCDC113
• Synonyms: CCDC113; coiled-coil domain containing 113; HSPC065; coiled-coil domain-containing protein 113
• Gene ID: 29070
• mRNA Refseq: NM_001142302
• Protein Refseq: NP_001135774
• MIM: 616070
• UniProt ID: Q9H0I3