Recombinant Full Length Human CCDC113 Protein, GST-tagged

Cat.No. : CCDC113-3790HF
Product Overview : Human CCDC113 full-length ORF ( NP_054876.2, 1 a.a. - 377 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 377 amino acids
Description : CCDC113 (Coiled-Coil Domain Containing 113) is a Protein Coding gene.
Molecular Mass : 70.6 kDa
AA Sequence : MTDDESESVLSDSHEGSELELPVIQLCGLVEELSYVNSALKTETEMFEKYYAKLEPRDQRPPRLSEIKISAADYAQFRGRRRSKSRTGMDRGVGLTADQKLELVQKEVADMKDDLRHTRANAERDLQHHEAIIEEAEIRWSEVSREVHEFEKDILKAISKKKGSILATQKVMKYIEDMNRRRDNMKEKLRLKNVSLKVQRKKMLLQLRQKEEVSEALHDVDFQQLKIENAQFLETIEARNQELTQLKLSSGNTLQVLNAYKSKLHKAMEIYLNLDKEILLRKELLEKIEKETLQVEEDRAKAEAVNKRLRKQLAEFRAPQVMTYVREKILNADLEKSIRMWERKVEIAEMSLKGHRKAWNRMKITNEQLQADYLAGK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CCDC113 coiled-coil domain containing 113 [ Homo sapiens (human) ]
Official Symbol CCDC113
Synonyms CCDC113; coiled-coil domain containing 113; HSPC065; coiled-coil domain-containing protein 113
Gene ID 29070
mRNA Refseq NM_001142302
Protein Refseq NP_001135774
MIM 616070
UniProt ID Q9H0I3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CCDC113 Products

Required fields are marked with *

My Review for All CCDC113 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon