Recombinant Human CC2D1A, His-tagged
Cat.No. : | CC2D1A-26320TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 672-951 of Human CC2D1A with N terminal His tag; Predicted MWt 33 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | 672-951 a.a. |
Description : | This gene encodes a transcriptional repressor that binds to a conserved 14-bp 5-repressor element and regulates expression of the 5-hydroxytryptamine (serotonin) receptor 1A gene in neuronal cells. The DNA binding and transcriptional repressor activities of the protein are inhibited by calcium. A mutation in this gene results in nonsyndromic mental retardation-3. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 106 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GLSPGDLDVFVRFDFPYPNVEEAQKDKTSVIKNTDSPEFK EQFKLCINRSHRGFRRAIQTKGIKFEVVHKGGLFKTDR VLGTAQLKLDALEIACEVREILEVLDGRRPTGGRLEVM VRIREPLTAQQLETTTERWLVIDPVPAAVPTQVAGPKG KAPPVPAPARESGNRSARPLHSLSVLAFDQERLERKILALRQARRPVPPEVAQQYQDIMQRSQWQRAQLEQGGVGIRR EYAAQLERQLQFYTEAARRLGNDGSRDAAKEALYRRNL VESELQRLRR |
Gene Name | CC2D1A coiled-coil and C2 domain containing 1A [ Homo sapiens ] |
Official Symbol | CC2D1A |
Synonyms | CC2D1A; coiled-coil and C2 domain containing 1A; coiled-coil and C2 domain-containing protein 1A; FLJ20241; mental retardation; nonsyndromic; autosomal recessive; 3; MRT3; |
Gene ID | 54862 |
mRNA Refseq | NM_017721 |
Protein Refseq | NP_060191 |
MIM | 610055 |
Uniprot ID | Q6P1N0 |
Chromosome Location | 19p13.12 |
Pathway | SIDS Susceptibility Pathways, organism-specific biosystem; |
Function | DNA binding; signal transducer activity; |
◆ Recombinant Proteins | ||
RFL8637BF | Recombinant Full Length Bovine Voltage-Dependent Calcium Channel Gamma-1 Subunit(Cacng1) Protein, His-Tagged | +Inquiry |
ERBB3-128H | Recombinant Human ERBB3 Protein, DDK-tagged | +Inquiry |
GTDC2-1257H | Recombinant Human GTDC2 | +Inquiry |
PPIC-6980M | Recombinant Mouse PPIC Protein, His (Fc)-Avi-tagged | +Inquiry |
PSPH-3088H | Recombinant Full Length Human PSPH Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
VTN -51P | Native Porcine multimeric vitronectin | +Inquiry |
Glycogen-016B | Native bovine liver Glycogen | +Inquiry |
KLK3-386H | Native Human Prostate Specific Antigen | +Inquiry |
Calprotectin-12HFL | Native Human Calprotectin Protein | +Inquiry |
IgG-05T | Native Toxoplasma gondii IgG antigen, RH strain | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDN10-362HCL | Recombinant Human CLDN10 cell lysate | +Inquiry |
CDH18-765CCL | Recombinant Cynomolgus CDH18 cell lysate | +Inquiry |
VWA5A-373HCL | Recombinant Human VWA5A 293 Cell Lysate | +Inquiry |
NP-CoV-001HCL | Recombinant HCoV-EMC/2012 NP-CoV cell lysate | +Inquiry |
DAD1-215HCL | Recombinant Human DAD1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CC2D1A Products
Required fields are marked with *
My Review for All CC2D1A Products
Required fields are marked with *
0
Inquiry Basket