Recombinant Human Cbl proto oncogene Protein, His tagged

Description :	This gene is a proto-oncogene that encodes a RING finger E3 ubiquitin ligase. The encoded protein is one of the enzymes required for targeting substrates for degradation by the proteasome. This protein mediates the transfer of ubiquitin from ubiquitin conjugating enzymes (E2) to specific substrates. This protein also contains an N-terminal phosphotyrosine binding domain that allows it to interact with numerous tyrosine-phosphorylated substrates and target them for proteasome degradation. As such it functions as a negative regulator of many signal transduction pathways. This gene has been found to be mutated or translocated in many cancers including acute myeloid leukaemia, and expansion of CGG repeats in the 5'' UTR has been associated with Jacobsen syndrome. Mutations in this gene are also the cause of Noonan syndrome-like disorder.
Source :	E. coli
Species :	Human
Tag :	C-His
Protein length :	775-906 aa
Molecular Mass :	15 kDa
AA Sequence :	MDVPKPPVPAVLARRTLSDISNASSSFGWLSLDGDPTTNVTEGSQVPERPPKPFPRRINSERKAGSCQQGSGPAASAATASPQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFVSISSPAHVATHHHHHHHH
Endotoxin :	< 1 EU/μg by LAL
Purity :	> 90% by SDS-PAGE
Storage :	Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer :	Sterile PBS, pH8.3
Concentration :	1 mg/mL by BCA

Gene Name	CBL Cbl proto-oncogene [ Homo sapiens (human) ]
Official Symbol	CBL
Synonyms	CBL; Cbl proto-oncogene, E3 ubiquitin protein ligase; Cas Br M (murine) ecotropic retroviral transforming sequence, CBL2; E3 ubiquitin-protein ligase CBL; c Cbl; oncogene CBL2; RNF55; proto-oncogene c-Cbl; RING finger protein 55; signal transduction protein CBL; casitas B-lineage lymphoma proto-oncogene; Cas-Br-M (murine) ecotropic retroviral transforming sequence; CBL2; NSLL; C-CBL
Gene ID	867
mRNA Refseq	NM_005188
Protein Refseq	NP_005179
MIM	165360
UniProt ID	P22681