Recombinant Human CATSPER1 protein(1-445aa), His-tagged
Cat.No. : | CATSPER1-6543H |
Product Overview : | Recombinant Human CATSPER1 protein(Q8NEC5)(1-445aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-445aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 52.7 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MDQNSVPEKAQNEADTNNADRFFRSHSSPPHHRPGHSRALHHYELHHHGVPHQRGESHHPPEFQDFHDQALSSHVHQSHHHSEARNHGRAHGPTGFGLAPSQGAVPSHRSYGEDYHDELQRDGRRHHDGSQYGGFHQQSDSHYHRGSHHGRPQYLGENLSHYSSGVPHHGEASHHGGSYLPHGPNPYSESFHHSEASHLSGLQHDESQHHQVPHRGWPHHHQVHHHGRSRHHEAHQHGKSPHHGETISPHSSVGSYQRGISDYHSEYHQGDHHPSEYHHGDHPHHTQHHYHQTHRHRDYHQHQDHHGAYHSSYLHGDYVQSTSQLSIPHTSRSLIHDAPGPAASRTGVFPYHVAHPRGSAHSMTRSSSTIRSRVTQMSKKVHTQDISTKHSEDWGKEEGQFQKRKTGRLQRTRKKGHSTNLFQWLWEKLTFLIQGFREMIRNLTQ |
Gene Name | CATSPER1 cation channel, sperm associated 1 [ Homo sapiens ] |
Official Symbol | CATSPER1 |
Synonyms | CATSPER1; cation channel, sperm associated 1; cation channel sperm-associated protein 1; CATSPER; hCatSper; sperm ion channel; sperm-associated cation channel 1; SPGF7; MGC33335; MGC33368; |
Gene ID | 117144 |
mRNA Refseq | NM_053054 |
Protein Refseq | NP_444282 |
MIM | 606389 |
UniProt ID | Q8NEC5 |
◆ Recombinant Proteins | ||
CATSPER1-0445H | Recombinant Human CATSPER1 Protein, GST-Tagged | +Inquiry |
CATSPER1-10746H | Recombinant Human CATSPER1, GST-tagged | +Inquiry |
CATSPER1-2753HF | Recombinant Full Length Human CATSPER1 Protein, GST-tagged | +Inquiry |
CATSPER1-6543H | Recombinant Human CATSPER1 protein(1-445aa), His-tagged | +Inquiry |
RFL23864HF | Recombinant Full Length Human Cation Channel Sperm-Associated Protein 1(Catsper1) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CATSPER1 Products
Required fields are marked with *
My Review for All CATSPER1 Products
Required fields are marked with *
0
Inquiry Basket