Recombinant Full Length Mouse Cation Channel Sperm-Associated Protein 1(Catsper1) Protein, His-Tagged
Cat.No. : | RFL22537MF |
Product Overview : | Recombinant Full Length Mouse Cation channel sperm-associated protein 1(Catsper1) Protein (Q91ZR5) (1-686aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-686) |
Form : | Lyophilized powder |
AA Sequence : | MDQSSRRDESYHETHPGSLDPSHQSHPHPHPHPTLHRPNQGGVYYDSPQHGMFQQPYQQH GGFHQQNELQHLREFSDSHDNAFSHHSYQQDRAGVSTLPNNISHAYGGSHPLAESQHSGG PQSGPRIDPNHHPHQDDPHRPSEPLSHPSSTGSHQGTTHQQYHERSHHLNPQQNRDHADT ISYRSSTRFYRSHAPFSRQERPHLHADHHHEGHHAHSHHGEHPHHKEQRHYHGDHMHHHI HHRSPSASQLSHKSHSTLATSPSHVGSKSTASGARYTFGARSQIFGKAQSRESLRESASL SEGEDHVQKRKKAQRAHKKAHTGNIFQLLWEKISHLLLGLQQMILSLTQSLGFETFIFIV VCLNTVILVAQTFTELEIRGEWYFMVLDSIFLSIYVLEAVLKLIALGLEYFYDPWNNLDF FIMVMAVLDFVLLQINSLSYSFYNHSLFRILKVFKSMRALRAIRVLRRLSILTSLHEVAG TLSGSLPSITAILTLMFTCLFLFSVVLRALFQDSDPKRFQNIFTTLFTLFTMLTLDDWSL IYIDNRAQGAWYIIPILMIYIVIQYFIFLNLVIAVLVDNFQMALLKGLEKVKLEQAARVH EKLLDDSLTDLNKADANAQMTEEALKMQLIEGMFGNMTVKQRVLHFQFLQLVAAVEQHQQ KFRSQAYVIDELVDMAFEAGDDDYGK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Catsper1 |
Synonyms | Catsper1; Cation channel sperm-associated protein 1; CatSper1 |
UniProt ID | Q91ZR5 |
◆ Recombinant Proteins | ||
RPS6KB2-14500M | Recombinant Mouse RPS6KB2 Protein | +Inquiry |
ADRM1-90R | Recombinant Rhesus Macaque ADRM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ALDO-438S | Recombinant Streptomyces coelicolor A3(2) ALDO protein, His-tagged | +Inquiry |
JAM2-1227H | Recombinant Human JAM2 Protein (Tyr74-Val250), N-His tagged | +Inquiry |
IL21-2205C | Recombinant Chicken IL21 | +Inquiry |
◆ Native Proteins | ||
Hyaluronidase-35O | Active Native Ovine Hyaluronidase, 300U/mg | +Inquiry |
Lectin-1791H | Active Native Hippeastrum Hybrid Lectin Protein, Biotinylated | +Inquiry |
CA72-4-160H | Native Human Cancer Antigen 72-4 | +Inquiry |
LOC780933-1B | Native Bovine Anhydrotrypsin | +Inquiry |
LDL-404H | Native Human Low Density Lipoprotein, Oxidized, Biotin labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM9-926HCL | Recombinant Human TMEM9 293 Cell Lysate | +Inquiry |
ADRA2C-8999HCL | Recombinant Human ADRA2C 293 Cell Lysate | +Inquiry |
CCDC140-7778HCL | Recombinant Human CCDC140 293 Cell Lysate | +Inquiry |
CBFA2T3-286HCL | Recombinant Human CBFA2T3 cell lysate | +Inquiry |
SLC27A2-1750HCL | Recombinant Human SLC27A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Catsper1 Products
Required fields are marked with *
My Review for All Catsper1 Products
Required fields are marked with *
0
Inquiry Basket