Recombinant Human CAST

• Cat.No.: CAST-27210TH
• Product Overview: Recombinant fragment corresponding to amino acids 582-669 of Human Calpastatin with an N terminal proprietary tag; Predicted MWt 35.31 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 88 amino acids
• Description: The protein encoded by this gene is an endogenous calpain (calcium-dependent cysteine protease) inhibitor. It consists of an N-terminal domain L and four repetitive calpain-inhibition domains (domains 1-4), and it is involved in the proteolysis of amyloid precursor protein. The calpain/calpastatin system is involved in numerous membrane fusion events, such as neural vesicle exocytosis and platelet and red-cell aggregation. The encoded protein is also thought to affect the expression levels of genes encoding structural or regulatory proteins. Alternatively spliced transcript variants encoding different isoforms have been described.
• Molecular Weight: 35.310kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: QPDPDENKPMEDKVKEKAKAEHRDKLGERDDTIPPEYRHLLDDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQ
• Sequence Similarities: Belongs to the protease inhibitor I27 (calpastatin) family.

Gene Information

• Gene Name: CAST calpastatin [ Homo sapiens ]
• Official Symbol: CAST
• Synonyms: CAST; calpastatin
• Gene ID: 831
• mRNA Refseq: NM_001042440
• Protein Refseq: NP_001035905
• MIM: 114090
• Uniprot ID: P20810
• Chromosome Location: 5q14-q22
• Function: calcium-dependent cysteine-type endopeptidase inhibitor activity; endopeptidase inhibitor activity; protein binding