Recombinant Human CASQ2 protein, GST-tagged

Cat.No. : CASQ2-301241H
Product Overview : Recombinant Human CASQ2 (273-399 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Phe273-Glu399
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : FAEKSDPDGYEFLEILKQVARDNTDNPDLSILWIDPDDFPLLVAYWEKTFKIDLFRPQIGVVNVTDADSVWMEIPDDDDLPTAEELEDWIEDVLSGKINTEDDDEDDDDDDNSDEEDNDDSDDDDDE
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name CASQ2 calsequestrin 2 (cardiac muscle) [ Homo sapiens ]
Official Symbol CASQ2
Synonyms CASQ2; calsequestrin 2 (cardiac muscle); calsequestrin-2; PDIB2; calsequestrin, cardiac muscle isoform; calsequestrin 2, fast-twitch, cardiac muscle; FLJ26321; FLJ93514;
Gene ID 845
mRNA Refseq NM_001232
Protein Refseq NP_001223
MIM 114251
UniProt ID O14958

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CASQ2 Products

Required fields are marked with *

My Review for All CASQ2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon