Recombinant Human CASP2 protein, His-SUMO-tagged

• Cat.No.: CASP2-2636H
• Product Overview: Recombinant Human CASP2 protein(P42575)(2-452aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His&SUMO
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 66.6 kDa
• Protein length: 2-452aa
• AA Sequence: AAPSAGSWSTFQHKELMAADRGRRILGVCGMHPHHQETLKKNRVVLAKQLLLSELLEHLLEKDIITLEMRELIQAKVGSFSQNVELLNLLPKRGPQAFDAFCEALRETKQGHLEDMLLTTLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPVCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHAGSPGCEESDAGKEKLPKMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNALIKDREGYAPGTEFHRCKEMSEYCSTLCRHLYLFPGHPPT
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CASP2 caspase 2, apoptosis-related cysteine peptidase [ Homo sapiens ]
• Official Symbol: CASP2
• Synonyms: CASP2; caspase 2, apoptosis-related cysteine peptidase; NEDD2, neural precursor cell expressed, developmentally down regulated 2; caspase-2; ICH1; PPP1R57; protein phosphatase 1; regulatory subunit 57; protease ICH-1; protein phosphatase 1, regulatory subunit 57; neural precursor cell expressed developmentally down-regulated protein 2; NEDD2; CASP-2; NEDD-2
• Gene ID: 835
• mRNA Refseq: NM_001224
• Protein Refseq: NP_001215
• MIM: 600639
• UniProt ID: P42575