Recombinant Human CARD11 Protein, GST-Tagged

• Cat.No.: CARD11-0391H
• Product Overview: Human CARD11 partial ORF (NP_115791, 481 a.a. - 580 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene belongs to the membrane-associated guanylate kinase (MAGUK) family, a class of proteins that functions as molecular scaffolds for the assembly of multiprotein complexes at specialized regions of the plasma membrane. This protein is also a member of the CARD protein family, which is defined by carrying a characteristic caspase-associated recruitment domain (CARD). This protein has a domain structure similar to that of CARD14 protein. The CARD domains of both proteins have been shown to specifically interact with BCL10, a protein known to function as a positive regulator of cell apoptosis and NF-kappaB activation. When expressed in cells, this protein activated NF-kappaB and induced the phosphorylation of BCL10. [provided by RefSeq, Jul 2008]
• Molecular Mass: 36.74 kDa
• AA Sequence: KYFLPYHPPQRRMNLKGIQLQRAKSPISLKRTSDFQAKGHEEEGTDASPSSCGSLPITNSFTKMQPPRSRSSIMSITAEPPGNDSIVRRYKEDAPHRSTV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CARD11 caspase recruitment domain family, member 11 [ Homo sapiens ]
• Official Symbol: CARD11
• Synonyms: CARD11; caspase recruitment domain family, member 11; caspase recruitment domain-containing protein 11; bcl10 interacting maguk protein 3; BIMP3; card maguk protein 1; CARMA1; carma 1; card-maguk protein 1; CARD-containing MAGUK protein 1; bcl10-interacting maguk protein 3; MGC133069
• Gene ID: 84433
• mRNA Refseq: NM_032415
• Protein Refseq: NP_115791
• MIM: 607210
• UniProt ID: Q9BXL7