Recombinant Human CAPS2 Protein, GST-Tagged
Cat.No. : | CAPS2-0379H |
Product Overview : | Human CAPS2 full-length ORF (AAH56672.1, 1 a.a. - 293 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Calcyphosine-2 is a calcium-binding protein with 2 EF-hand motifs (Wang et al., 2002 [PubMed 11846421]).[supplied by OMIM, Mar 2008] |
Molecular Mass : | 60.1 kDa |
AA Sequence : | MIDHLSRAVISDPEQNLAIEQKESDHILPDSKMTPLRFRKRTLHETKIRTHSTLTENVLSHKLQFDGRIVSRTNVLPFIQKSIYSHQCGRRKGKQYRLGDFYVGATLTFLSSDHLSLPESIKENTLLKLRITNIDQIALDSLKTASMEQEDDIIIQETNDRLVFKAIQDVLKEKLHKRGVRILTGLGKYFQQLDKEGNGLLDKADFKQALKVFHLEVSEKDFESAWLILNDNGNGKVDYGEFKRGIIGEMNEYRKSYVRKAFMKLDFNKSGSVPIINIRKCYCAKKHSQVISG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CAPS2 calcyphosine 2 [ Homo sapiens ] |
Official Symbol | CAPS2 |
Synonyms | CAPS2; calcyphosine 2; calcyphosphine 2; calcyphosin-2; calcyphosine-2; UG0636c06; FLJ34520; |
Gene ID | 84698 |
mRNA Refseq | NM_032606 |
Protein Refseq | NP_115995 |
MIM | 607724 |
UniProt ID | Q9BXY5 |
◆ Recombinant Proteins | ||
CAPS2-2844HF | Recombinant Full Length Human CAPS2 Protein, GST-tagged | +Inquiry |
Caps2-1720R | Recombinant Rat Caps2 protein, His & T7-tagged | +Inquiry |
CAPS2-0379H | Recombinant Human CAPS2 Protein, GST-Tagged | +Inquiry |
Caps2-363M | Recombinant Mouse Caps2 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CAPS2 Products
Required fields are marked with *
My Review for All CAPS2 Products
Required fields are marked with *
0
Inquiry Basket