Recombinant Human CAPS2 Protein, GST-Tagged

• Cat.No.: CAPS2-0379H
• Product Overview: Human CAPS2 full-length ORF (AAH56672.1, 1 a.a. - 293 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Calcyphosine-2 is a calcium-binding protein with 2 EF-hand motifs (Wang et al., 2002 [PubMed 11846421]).[supplied by OMIM, Mar 2008]
• Molecular Mass: 60.1 kDa
• AA Sequence: MIDHLSRAVISDPEQNLAIEQKESDHILPDSKMTPLRFRKRTLHETKIRTHSTLTENVLSHKLQFDGRIVSRTNVLPFIQKSIYSHQCGRRKGKQYRLGDFYVGATLTFLSSDHLSLPESIKENTLLKLRITNIDQIALDSLKTASMEQEDDIIIQETNDRLVFKAIQDVLKEKLHKRGVRILTGLGKYFQQLDKEGNGLLDKADFKQALKVFHLEVSEKDFESAWLILNDNGNGKVDYGEFKRGIIGEMNEYRKSYVRKAFMKLDFNKSGSVPIINIRKCYCAKKHSQVISG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CAPS2 calcyphosine 2 [ Homo sapiens ]
• Official Symbol: CAPS2
• Synonyms: CAPS2; calcyphosine 2; calcyphosphine 2; calcyphosin-2; calcyphosine-2; UG0636c06; FLJ34520
• Gene ID: 84698
• mRNA Refseq: NM_032606
• Protein Refseq: NP_115995
• MIM: 607724
• UniProt ID: Q9BXY5