Recombinant Full Length Human CAPS2 Protein, GST-tagged

Cat.No. : CAPS2-2844HF
Product Overview : Human CAPS2 full-length ORF (AAH56672.1, 1 a.a. - 293 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 293 amino acids
Description : Calcyphosine-2 is a calcium-binding protein with 2 EF-hand motifs (Wang et al., 2002 [PubMed 11846421]).[supplied by OMIM, Mar 2008]
Molecular Mass : 60.1 kDa
AA Sequence : MIDHLSRAVISDPEQNLAIEQKESDHILPDSKMTPLRFRKRTLHETKIRTHSTLTENVLSHKLQFDGRIVSRTNVLPFIQKSIYSHQCGRRKGKQYRLGDFYVGATLTFLSSDHLSLPESIKENTLLKLRITNIDQIALDSLKTASMEQEDDIIIQETNDRLVFKAIQDVLKEKLHKRGVRILTGLGKYFQQLDKEGNGLLDKADFKQALKVFHLEVSEKDFESAWLILNDNGNGKVDYGEFKRGIIGEMNEYRKSYVRKAFMKLDFNKSGSVPIINIRKCYCAKKHSQVISG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CAPS2 calcyphosine 2 [ Homo sapiens ]
Official Symbol CAPS2
Synonyms CAPS2; calcyphosine 2; calcyphosphine 2; calcyphosin-2; calcyphosine-2; UG0636c06; FLJ34520;
Gene ID 84698
mRNA Refseq NM_032606
Protein Refseq NP_115995
MIM 607724
UniProt ID Q9BXY5

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CAPS2 Products

Required fields are marked with *

My Review for All CAPS2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon