Recombinant Human CAPN7 Protein, GST-tagged
Cat.No. : | CAPN7-34H |
Product Overview : | Recombinant Human CAPN7(714 a.a. - 813 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 714 a.a. - 813 a.a. |
Description : | Calpains are ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. The calpain proteins are heterodimers consisting of an invariant small subunit and variable large subunits. The large subunit possesses a cysteine protease domain, and both subunits possess calcium-binding domains. Calpains have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. The function of the protein encoded by this gene is not known. An orthologue has been found in mouse but it seems to diverge from other family members. The mouse orthologue is thought to be calcium independent with protease activity. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | NPIYQFHIEKTGPLLIELRGPRQYSVGFEVVTVSTLGDPGPHGFLRKSSGDYRCGFCYLELENIPSGIFNIIPSTFLPKQEGPFFLDFNSIIPIKITQLQ |
Applications : | Enzyme-linked Immunoabsorbent; Assay Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | CAPN7 calpain 7 [ Homo sapiens ] |
Official Symbol | CAPN7 |
Synonyms | PALBH; CALPAIN7; calpain like protease; homolog of Aspergillus Nidulans PALB; palB homolog |
Gene ID | 23473 |
mRNA Refseq | NM_014296 |
Protein Refseq | NP_055111 |
MIM | 606400 |
UniProt ID | Q9Y6W3 |
◆ Recombinant Proteins | ||
CAPN7-1219M | Recombinant Mouse CAPN7 Protein, His (Fc)-Avi-tagged | +Inquiry |
CAPN7-235H | Recombinant Human CAPN7 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
CAPN7-2698M | Recombinant Mouse CAPN7 Protein | +Inquiry |
CAPN7-33H | Recombinant Human CAPN7 Protein, GST-tagged | +Inquiry |
CAPN7-34H | Recombinant Human CAPN7 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAPN7-7860HCL | Recombinant Human CAPN7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CAPN7 Products
Required fields are marked with *
My Review for All CAPN7 Products
Required fields are marked with *
0
Inquiry Basket