Recombinant Human CAPN1, His-tagged

• Cat.No.: CAPN1-27399TH
• Product Overview: Recombinant fragment, corresponding to amino acids 214-500 of Human Calpain 1 with N terminal His tag; 287 amino acids, 33kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 214-500 a.a.
• Description: The calpains, calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammalian calpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist of heterodimers with distinct large, catalytic subunits associated with a common small, regulatory subunit. This gene encodes the large subunit of the ubiquitous enzyme, calpain 1. Several transcript variants encoding two different isoforms have been found for this gene.
• Conjugation: HIS
• Tissue specificity: Ubiquitous.
• Form: Lyophilised:Reconstitute with 121 μl distilled water.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: FEDFTGGVTEWYELRKAPSDLYQIILKALERGSLLGCSID ISSVLDMEAITFKKLVKGHAYSVTGAKQVNYRGQVVSL IRMRNPWGEVEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLEICNLTPDALKSRTIRKWNTT LYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLDETDDP DDYGDRESGCSFVLALMQKHRRRERRFGRDMETIGFAVYE VPPELVGQPAVHLKRDFFLANASRARSEQFINLREVST RFRLPPGEYVVVPST
• Sequence Similarities: Belongs to the peptidase C2 family.Contains 1 calpain catalytic domain.Contains 4 EF-hand domains.

Gene Information

• Gene Name: CAPN1 calpain 1, (mu/I) large subunit [ Homo sapiens ]
• Official Symbol: CAPN1
• Synonyms: CAPN1; calpain 1, (mu/I) large subunit; calpain-1 catalytic subunit; CANP; CANPL1; muCANP; muCL
• Gene ID: 823
• mRNA Refseq: NM_001198868
• Protein Refseq: NP_001185797
• MIM: 114220
• Uniprot ID: P07384
• Chromosome Location: 11q13
• Pathway: Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem; Focal Adhesion, organism-specific biosystem
• Function: calcium ion binding; calcium-dependent cysteine-type endopeptidase activity; peptidase activity