Recombinant Human CALY Protein, GST-Tagged

• Cat.No.: CALY-0316H
• Product Overview: Human CALY full-length ORF (AAH38978.1, 1 a.a. - 217 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is a type II single transmembrane protein. It is required for maximal stimulated calcium release after stimulation of purinergic or muscarinic but not beta-adrenergic receptors. The encoded protein interacts with D1 dopamine receptor and may interact with other DA receptor subtypes and/or GPCRs. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 50.27 kDa
• AA Sequence: MVKLGCSFSGKPGKDPGDQDGAAMDSVPLISPLDISQLQPPLPDQVVIKTQTEYQLSSPDQQNFPDLEGQRLNCSHPEEGRRLPTARMIAFAMALLGCVLIMYKAIWYDQFTCPDGFLLRHKICTPLTLEMYYTEMDPERHRSILAAIGAYPLSRKHGTETPAAWGDGYRAAKEERKGPTQAGAAAAATEPPGKPSAKAEKEAARKAAGSAAPPPAQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CALY calcyon neuron-specific vesicular protein [ Homo sapiens ]
• Official Symbol: CALY
• Synonyms: CALY; calcyon neuron-specific vesicular protein; dopamine receptor D1 interacting protein, DRD1IP; neuron-specific vesicular protein calcyon; CALCYON; NSG3; calcyon protein; D1 dopamine receptor-interacting protein; dopamine receptor D1 interacting protein; calcyon D1 dopamine receptor-interacting protein (CALCYON); DRD1IP; RP11-122K13.5
• Gene ID: 50632
• mRNA Refseq: NM_015722
• Protein Refseq: NP_056537
• MIM: 604647
• UniProt ID: Q9NYX4