Recombinant Full Length Human CALY Protein, GST-tagged

Cat.No. : CALY-3083HF
Product Overview : Human CALY full-length ORF (AAH38978.1, 1 a.a. - 217 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The protein encoded by this gene is a type II single transmembrane protein. It is required for maximal stimulated calcium release after stimulation of purinergic or muscarinic but not beta-adrenergic receptors. The encoded protein interacts with D1 dopamine receptor and may interact with other DA receptor subtypes and/or GPCRs. [provided by RefSeq, Jul 2008]
Source : In Vitro Cell Free System
Species : Human
Tag : GST
Molecular Mass : 50.27 kDa
Protein length : 217 amino acids
AA Sequence : MVKLGCSFSGKPGKDPGDQDGAAMDSVPLISPLDISQLQPPLPDQVVIKTQTEYQLSSPDQQNFPDLEGQRLNCSHPEEGRRLPTARMIAFAMALLGCVLIMYKAIWYDQFTCPDGFLLRHKICTPLTLEMYYTEMDPERHRSILAAIGAYPLSRKHGTETPAAWGDGYRAAKEERKGPTQAGAAAAATEPPGKPSAKAEKEAARKAAGSAAPPPAQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CALY calcyon neuron-specific vesicular protein [ Homo sapiens ]
Official Symbol CALY
Synonyms CALY; calcyon neuron-specific vesicular protein; dopamine receptor D1 interacting protein, DRD1IP; neuron-specific vesicular protein calcyon; CALCYON; NSG3; calcyon protein; D1 dopamine receptor-interacting protein; dopamine receptor D1 interacting protein; calcyon D1 dopamine receptor-interacting protein (CALCYON); DRD1IP; RP11-122K13.5;
Gene ID 50632
mRNA Refseq NM_015722
Protein Refseq NP_056537
MIM 604647
UniProt ID Q9NYX4

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CALY Products

Required fields are marked with *

My Review for All CALY Products

Required fields are marked with *

0

Inquiry Basket

cartIcon