Description :	CALCB (Calcitonin Related Polypeptide Beta) is a Protein Coding gene. Diseases associated with CALCB include Medullary Thyroid Carcinoma, Familial. Among its related pathways are Presynaptic function of Kainate receptors and Peptide ligand-binding receptors. GO annotations related to this gene include hormone activity and neuropeptide hormone activity. An important paralog of this gene is CALCA.
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	41.3 kDa
AA Sequence :	MKKEANLQRGGMGFRKFSPFLALSILVLYQAGSLQAAPFRSALEGSPDPATLSKEDARLLLAALVQDYVQMKASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFGRRRRDLQA
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	CALCB calcitonin-related polypeptide beta [ Homo sapiens ]
Official Symbol	CALCB
Synonyms	CALCB; calcitonin-related polypeptide beta; CALC2, calcitonin 2; calcitonin gene-related peptide 2; CGRP II; FLJ30166; beta-CGRP; calcitonin 2; beta-type CGRP; calcitonin gene-related peptide II; CALC2; CGRP2; CGRP-II;
Gene ID	797
mRNA Refseq	NM_000728
Protein Refseq	NP_000719
MIM	114160
UniProt ID	P10092

ACE2-735H	Recombinant Human ACE2 Protein, His-tagged	+Inquiry
FGF10-15H	Active Recombinant Human FGF10 protein	+Inquiry
KITLG-19H	Active Recombinant Human KITLG Protein, Pre-aliquoted	+Inquiry
DEFB1-17H	Active Recombinant Human DEFB1 protein(1-47aa)	+Inquiry
DEFB4-18H	Active Recombinant Human DEFB4 protein(1-50aa)	+Inquiry