Recombinant Human CALCB Protein, GST-Tagged

• Cat.No.: CALCB-0291H
• Product Overview: Human CALCB full-length ORF (1 a.a. - 138 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CALCB (Calcitonin Related Polypeptide Beta) is a Protein Coding gene. Diseases associated with CALCB include Medullary Thyroid Carcinoma, Familial. Among its related pathways are Presynaptic function of Kainate receptors and Peptide ligand-binding receptors. GO annotations related to this gene include hormone activity and neuropeptide hormone activity. An important paralog of this gene is CALCA.
• Molecular Mass: 41.3 kDa
• AA Sequence: MKKEANLQRGGMGFRKFSPFLALSILVLYQAGSLQAAPFRSALEGSPDPATLSKEDARLLLAALVQDYVQMKASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFGRRRRDLQA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CALCB calcitonin-related polypeptide beta [ Homo sapiens ]
• Official Symbol: CALCB
• Synonyms: CALCB; calcitonin-related polypeptide beta; CALC2, calcitonin 2; calcitonin gene-related peptide 2; CGRP II; FLJ30166; beta-CGRP; calcitonin 2; beta-type CGRP; calcitonin gene-related peptide II; CALC2; CGRP2; CGRP-II
• Gene ID: 797
• mRNA Refseq: NM_000728
• Protein Refseq: NP_000719
• MIM: 114160
• UniProt ID: P10092