Description :	CGRP induces vasodilation. It dilates a variety of vessels including the coronary, cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role.
Source :	E. coli
Species :	Human
Tag :	GST
Form :	Supplied as a 0.2 µM filtered solution of PBS, pH 7.4, 50% glycerol
Molecular Mass :	40.9kD
AA Sequence :	MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSENLYFQGHMGFRKFSPFLALSILVLYQAG
Endotoxin :	Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity :	>95% as determined by SDS-PAGE and Coomassie blue staining

Gene Name	CALCB calcitonin-related polypeptide beta [ Homo sapiens ]
Official Symbol	CALCB
Synonyms	CALCB; calcitonin-related polypeptide beta; CALC2, calcitonin 2; calcitonin gene-related peptide 2; CGRP II; FLJ30166; beta-CGRP; calcitonin 2; beta-type CGRP; calcitonin gene-related peptide II; CALC2; CGRP2; CGRP-II;
Gene ID	797
mRNA Refseq	NM_000728
Protein Refseq	NP_000719
MIM	114160
UniProt ID	P10092

RRM2-705H	Recombinant Full Length Human Ribonucleotide Reductase M2, His-tagged	+Inquiry
FIS1-2477H	Recombinant Human FIS1, His-tagged	+Inquiry
RAB27A-2479H	Recombinant Human RAB27A, His-tagged	+Inquiry
RAB11A-2480H	Recombinant Human RAB11A, Member RAS Oncogene Family, His-tagged	+Inquiry
ADK-2481H	Recombinant Human Adenosine Kinase, His-tagged	+Inquiry