Recombinant Human CALB2 Protein, GST-Tagged

• Cat.No.: CALB2-0287H
• Product Overview: Human CALB2 full-length ORF (NP_009018.1, 1 a.a. - 179 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes an intracellular calcium-binding protein belonging to the troponin C superfamily. Members of this protein family have six EF-hand domains which bind calcium. This protein plays a role in diverse cellular functions, including message targeting and intracellular calcium buffering. It also functions as a modulator of neuronal excitability, and is a diagnostic marker for some human diseases, including Hirschsprung disease and some cancers. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2010]
• Molecular Mass: 47.1 kDa
• AA Sequence: MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSKSDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQHVGSSAEFMEAWRKYDTDRSGYIEANELKGFLSDLLKKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CALB2 calbindin 2 [ Homo sapiens ]
• Official Symbol: CALB2
• Synonyms: CALB2; calbindin 2; calbindin 2, 29kDa (calretinin); calretinin; CAL2; calbindin D29K; 29 kDa calbindin; calbindin 2, (29kD, calretinin); CR; CAB29
• Gene ID: 794
• mRNA Refseq: NM_001740
• Protein Refseq: NP_001731
• MIM: 114051
• UniProt ID: P22676